General Information

  • ID:  hor006609
  • Uniprot ID:  O73811
  • Protein name:  Progonadoliberin-2
  • Gene name:  gnrh2
  • Organism:  Morone saxatilis (Striped bass) (Perca saxatilis)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Morone (genus), Moronidae (family), Eupercaria incertae sedis, Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSHGWYPGGKRELDSFGTSEISEEIKLCEAGECSYLRPQRRNVLRNIILDALARELQKRK
  • Length:  62(24-85)
  • Propeptide:  MCVSRLVLLFGLLLCVGAQLSNAQHWSHGWYPGGKRELDSFGTSEISEEIKLCEAGECSYLRPQRRNVLRNIILDALARELQKRK
  • Signal peptide:  MCVSRLVLLFGLLLCVGAQLSNA
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O73811-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006609_AF2.pdbhor006609_ESM.pdb

Physical Information

Mass: 835846 Formula: C318H506N98O94S2
Absent amino acids: M Common amino acids: ELR
pI: 8.76 Basic residues: 13
Polar residues: 17 Hydrophobic residues: 18
Hydrophobicity: -88.39 Boman Index: -17233
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 78.71
Instability Index: 8646.94 Extinction Coefficient cystines: 14105
Absorbance 280nm: 231.23

Literature

  • PubMed ID:  9845669
  • Title:  Multiple GnRHs present in a teleost species are encoded by separate genes: analysis of the sbGnRH and cGnRH-II genes from the striped bass, Morone saxatilis.